PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 552aa    MW: 59863.9 Da    PI: 6.8113
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1762genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.3e-10410462557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  + 
  Gh_A03G1762 410 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSV 462
                  9******************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-17406470IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714408471IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.32E-11410461No hitNo description
PfamPF001709.4E-9410464IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-11410466No hitNo description
CDDcd147032.29E-24411460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MGDSEEGNTD LMQRIQSSFG TSSSSIPKQV LSMNRLEIPQ LNPNQIRAVR HFSHFGQNFN  60
GGGGGGGGGG DGNKRVGIPP SHPNQIPPVS PYSQIPVSRP SSHQMGSSQG FSLGPTHSRS  120
LSQPSSFFSF DSLPPLSPAP VSQISNDVCM EDSHSLLPPS PFPKASSPRV GESLPPRKSH  180
RRSNSDIPFG FNTVTPPVRG SGFENSGVPR PVQLVKKETS WERGIDGNVE GMGERKSEGE  240
VMDDLFSAYM NLDNIDALNS SEDKNNNNEN HEDLDSRASG TKTNGGDSSD NEAESSANES  300
GNSVTRGGVY STEKREGNKR SAGGDIAPTS RHYRSVSMDS FMGKLNFGDE SPKLPPSPGS  360
RPGQLSPSNS IDGNSAAFSL ELGNGEFSEA ELKKIMANEK LAEIAMTDPK RAKRILANRQ  420
SAARSKERKM RYISELEHKV QTLQTEATTL SAQLTLLQRD SVGLSNQNNE LKFRIQSMEQ  480
QAQLRDALNE TLTAEVRRLK LATQELGGDS DPSKGMVSQQ LPISRQMFQL HQQQFHQQQQ  540
NGNTAAKSES NQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.78981e-161boll| leaf| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480420.10.0PREDICTED: transcription factor RF2a
RefseqXP_012480421.10.0PREDICTED: transcription factor RF2a
TrEMBLA0A0B0NWR20.0A0A0B0NWR2_G
STRINGPOPTR_0009s12830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-135bZIP family protein